Lineage for d1ae7__ (1ae7 -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins) Protein Snake phospholipase A2 [48624] (12 species) 
Species Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId:8663] [48631] (1 PDB entry) 
Domain d1ae7__: 1ae7 - [19553]
Details for d1ae7__
PDB Entry: 1ae7 (more details), 2 Å
PDB Description: notexin, a presynaptic neurotoxic phospholipase a2
SCOP Domain Sequences for d1ae7__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ae7__ a.133.1.2 (-) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notexin}
nlvqfsyliqcanhgkrptwhymdygcycgaggsgtpvdeldrcckihddcydeagkkgc
fpkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrcq
SCOP Domain Coordinates for d1ae7__:
Click to download the PDB-style file with coordinates for d1ae7__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ae7__:
- d1ae7__ appears in SCOP 1.57
- d1ae7__ appears in the current release, SCOPe 2.08, called d1ae7a_
View in 3D