SCOPe 2.06: Domain d1a6eb1: 1a6e B:20-144,B:404-521

Lineage for d1a6eb1 (1a6e B:20-144,B:404-521)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
   multihelical; 8 helices arranged in 2 parallel layers

4. Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families)
   duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site

5. Family a.129.1.2: Group II chaperonin (CCT, TRIC), ATPase domain [48596] (1 protein)

6. Protein Thermosome, E domain [48597] (3 species)

7. Species Thermoplasma acidophilum, beta chain [TaxId:2303] [100917] (2 PDB entries)

8. Domain d1a6eb1: 1a6e B:20-144,B:404-521 [19491]
   Other proteins in same PDB: d1a6ea2, d1a6ea3, d1a6eb2, d1a6eb3
   complexed with adp, af3, mg

Details for d1a6eb1

PDB Entry: 1a6e, 3.2 Å

PDB Description: thermosome-mg-adp-alf3 complex

PDB Compounds: (B:) thermosome (beta subunit)

SCOPe Domain Sequences for d1a6eb1:

Sequence; same for both SEQRES and ATOM records:

>d1a6eb1 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domain {Thermoplasma acidophilum, beta chain [TaxId: 2303]}
kdamkenieaaiaisnsvrsslgprgmdkmlvdslgdivitndgvtilkemdvehpaakm
mvevsktqdsfvgdgtttaviiaggllqqaqglinqnvhptvisegyrmaseeakrvide
istkiXayaagggataaeiafrlrsyaqkiggrqqlaiekfadaieeipralaenagldp
idillklraehakgnktyginvftgeiedmvkngviepirvgkqaiesateaaimilrid
dvia

Timeline for d1a6eb1:

• d1a6eb1 first appeared (with stable ids) in SCOP 1.55
  
• d1a6eb1 appears in SCOPe 2.05
  
• d1a6eb1 appears in SCOPe 2.07
  
• d1a6eb1 appears in the current release, SCOPe 2.08