Lineage for d1a6eb1 (1a6e B:20-144,B:404-521)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749675Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 1749676Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 1749860Family a.129.1.2: Group II chaperonin (CCT, TRIC), ATPase domain [48596] (1 protein)
  6. 1749861Protein Thermosome, E domain [48597] (3 species)
  7. 1749886Species Thermoplasma acidophilum, beta chain [TaxId:2303] [100917] (2 PDB entries)
  8. 1749888Domain d1a6eb1: 1a6e B:20-144,B:404-521 [19491]
    Other proteins in same PDB: d1a6ea2, d1a6ea3, d1a6eb2, d1a6eb3
    complexed with adp, af3, mg

Details for d1a6eb1

PDB Entry: 1a6e (more details), 3.2 Å

PDB Description: thermosome-mg-adp-alf3 complex
PDB Compounds: (B:) thermosome (beta subunit)

SCOPe Domain Sequences for d1a6eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6eb1 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domain {Thermoplasma acidophilum, beta chain [TaxId: 2303]}
kdamkenieaaiaisnsvrsslgprgmdkmlvdslgdivitndgvtilkemdvehpaakm
mvevsktqdsfvgdgtttaviiaggllqqaqglinqnvhptvisegyrmaseeakrvide
istkiXayaagggataaeiafrlrsyaqkiggrqqlaiekfadaieeipralaenagldp
idillklraehakgnktyginvftgeiedmvkngviepirvgkqaiesateaaimilrid
dvia

SCOPe Domain Coordinates for d1a6eb1:

Click to download the PDB-style file with coordinates for d1a6eb1.
(The format of our PDB-style files is described here.)

Timeline for d1a6eb1: