Lineage for d1a6eb3 (1a6e B:145-215,B:368-403)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192441Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 2192442Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 2192626Family d.56.1.2: Group II chaperonin (CCT, TRIC), intermediate domain [54853] (1 protein)
  6. 2192627Protein Thermosome, I domain [54854] (3 species)
  7. 2192652Species Thermoplasma acidophilum, beta chain [TaxId:2303] [100974] (2 PDB entries)
  8. 2192654Domain d1a6eb3: 1a6e B:145-215,B:368-403 [38939]
    Other proteins in same PDB: d1a6ea1, d1a6ea2, d1a6eb1, d1a6eb2
    complexed with adp, af3, mg

Details for d1a6eb3

PDB Entry: 1a6e (more details), 3.2 Å

PDB Description: thermosome-mg-adp-alf3 complex
PDB Compounds: (B:) thermosome (beta subunit)

SCOPe Domain Sequences for d1a6eb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6eb3 d.56.1.2 (B:145-215,B:368-403) Thermosome, I domain {Thermoplasma acidophilum, beta chain [TaxId: 2303]}
gadekalllkmaqtslnsksasvakdklaeisyeavksvaelrdgkyyvdfdniqvvkkq
ggaiddtqlinXkavsilvrgetehvvdemersitdslhvvasaledg

SCOPe Domain Coordinates for d1a6eb3:

Click to download the PDB-style file with coordinates for d1a6eb3.
(The format of our PDB-style files is described here.)

Timeline for d1a6eb3: