SCOP 1.61: Domain d1a6eb1: 1a6e B:20-144,B:404-521

Lineage for d1a6eb1 (1a6e B:20-144,B:404-521)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.129: GroEL-like chaperone, ATPase domain [48591] (1 superfamily)

4. Superfamily a.129.1: GroEL-like chaperone, ATPase domain [48592] (2 families)

5. Family a.129.1.2: Group II chaperonin (CCT, TRIC) [48596] (1 protein)

6. Protein Thermosome [48597] (1 species)

7. Species Archaeon Thermoplasma acidophilum [TaxId:2303] [48598] (2 PDB entries)

8. Domain d1a6eb1: 1a6e B:20-144,B:404-521 [19491]
   Other proteins in same PDB: d1a6ea2, d1a6ea3, d1a6eb2, d1a6eb3

Details for d1a6eb1

PDB Entry: 1a6e, 3.2 Å

PDB Description: thermosome-mg-adp-alf3 complex

SCOP Domain Sequences for d1a6eb1:

Sequence; same for both SEQRES and ATOM records:

>d1a6eb1 a.129.1.2 (B:20-144,B:404-521) Thermosome {Archaeon Thermoplasma acidophilum}
kdamkenieaaiaisnsvrsslgprgmdkmlvdslgdivitndgvtilkemdvehpaakm
mvevsktqdsfvgdgtttaviiaggllqqaqglinqnvhptvisegyrmaseeakrvide
istkiXayaagggataaeiafrlrsyaqkiggrqqlaiekfadaieeipralaenagldp
idillklraehakgnktyginvftgeiedmvkngviepirvgkqaiesateaaimilrid
dvia

Timeline for d1a6eb1:

• d1a6eb1 first appeared (with stable ids) in SCOP 1.55
  
• d1a6eb1 appears in SCOP 1.59
  
• d1a6eb1 appears in SCOP 1.63
  
• d1a6eb1 appears in the current release, SCOPe 2.08