Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies) |
Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) |
Family c.8.5.2: Group II chaperonin (CCT, TRIC) [52034] (1 protein) |
Protein Thermosome [52035] (2 species) |
Species Archaeon Thermoplasma acidophilum [TaxId:2303] [52036] (5 PDB entries) |
Domain d1a6eb2: 1a6e B:216-367 [30823] Other proteins in same PDB: d1a6ea1, d1a6ea3, d1a6eb1, d1a6eb3 |
PDB Entry: 1a6e (more details), 3.2 Å
SCOP Domain Sequences for d1a6eb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6eb2 c.8.5.2 (B:216-367) Thermosome {Archaeon Thermoplasma acidophilum} giivdkekvhpgmpdvvkdakialldapleikkpefdtnlriedpsmiqkflaqeenmlr emvdkiksvganvvitqkgiddmaqhylsragiyavrrvkksdmdklakatgasivstid eisssdlgtaerveqvkvgedymtfvtgcknp
Timeline for d1a6eb2: