Lineage for d1a6eb1 (1a6e B:20-144,B:404-521)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101310Fold a.129: GroEL-like chaperones, ATPase domain [48591] (1 superfamily)
  4. 101311Superfamily a.129.1: GroEL-like chaperones, ATPase domain [48592] (2 families) (S)
  5. 101359Family a.129.1.2: Group II chaperonin (CCT, TRIC) [48596] (1 protein)
  6. 101360Protein Thermosome [48597] (1 species)
  7. 101361Species Archaeon Thermoplasma acidophilum [TaxId:2303] [48598] (2 PDB entries)
  8. 101365Domain d1a6eb1: 1a6e B:20-144,B:404-521 [19491]
    Other proteins in same PDB: d1a6ea2, d1a6ea3, d1a6eb2, d1a6eb3

Details for d1a6eb1

PDB Entry: 1a6e (more details), 3.2 Å

PDB Description: thermosome-mg-adp-alf3 complex

SCOP Domain Sequences for d1a6eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6eb1 a.129.1.2 (B:20-144,B:404-521) Thermosome {Archaeon Thermoplasma acidophilum}
kdamkenieaaiaisnsvrsslgprgmdkmlvdslgdivitndgvtilkemdvehpaakm
mvevsktqdsfvgdgtttaviiaggllqqaqglinqnvhptvisegyrmaseeakrvide
istkiXayaagggataaeiafrlrsyaqkiggrqqlaiekfadaieeipralaenagldp
idillklraehakgnktyginvftgeiedmvkngviepirvgkqaiesateaaimilrid
dvia

SCOP Domain Coordinates for d1a6eb1:

Click to download the PDB-style file with coordinates for d1a6eb1.
(The format of our PDB-style files is described here.)

Timeline for d1a6eb1: