SCOPe 2.07: Domain d3tb5b_: 3tb5 B:

Lineage for d3tb5b_ (3tb5 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.0: automated matches [194833] (1 protein)
   not a true family

6. Protein automated matches [194834] (4 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:565646] [194835] (1 PDB entry)

8. Domain d3tb5b_: 3tb5 B: [194837]
   automated match to d1o0xa_
   complexed with cit

Details for d3tb5b_

PDB Entry: 3tb5, 2.3 Å

PDB Description: Crystal Structure of the Enterococcus faecalis Methionine aminopeptidase apo form

PDB Compounds: (B:) Methionine aminopeptidase

SCOPe Domain Sequences for d3tb5b_:

Sequence; same for both SEQRES and ATOM records:

>d3tb5b_ d.127.1.0 (B:) automated matches {Enterococcus faecalis [TaxId: 565646]}
mitlkspreiemmdesgelladvhrhlrtfikpgitswdievfvrdfieshggvaaqigy
egykyatccsindeichgfprkkvlkdgdlikvdmcvdlkgaisdscwsyvvgestpeid
rlmevtkkalylgieqaqvgnrigdighaiqtyvegegygvvrdfvghgigptihespmi
phygeagkglrlkegmvitiepmvntgtwrmkmdpngwtaytedgglscqyehslaitke
gpriltsqgeelty

Timeline for d3tb5b_:

• d3tb5b_ first appeared in SCOPe 2.02
  
• d3tb5b_ appears in SCOPe 2.06
  
• d3tb5b_ appears in the current release, SCOPe 2.08