Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) |
Family d.127.1.0: automated matches [194833] (1 protein) not a true family |
Protein automated matches [194834] (4 species) not a true protein |
Species Enterococcus faecalis [TaxId:565646] [194835] (1 PDB entry) |
Domain d3tb5c_: 3tb5 C: [194836] automated match to d1o0xa_ complexed with cit |
PDB Entry: 3tb5 (more details), 2.3 Å
SCOPe Domain Sequences for d3tb5c_:
Sequence, based on SEQRES records: (download)
>d3tb5c_ d.127.1.0 (C:) automated matches {Enterococcus faecalis [TaxId: 565646]} tlkspreiemmdesgelladvhrhlrtfikpgitswdievfvrdfieshggvaaqigyeg ykyatccsindeichgfprkkvlkdgdlikvdmcvdlkgaisdscwsyvvgestpeidrl mevtkkalylgieqaqvgnrigdighaiqtyvegegygvvrdfvghgigptihespmiph ygeagkglrlkegmvitiepmvntgtwrmkmdpngwtaytedgglscqyehslaitkegp riltsqgeelty
>d3tb5c_ d.127.1.0 (C:) automated matches {Enterococcus faecalis [TaxId: 565646]} tlkspreiemmdesgelladvhrhlrtfikpgitswdievfvrdfieshggvaayatccs indeichgfprkkvlkdgdlikvdmcvdlkgaisdscwsyvvgestpeidrlmevtkkal ylgieqaqvgnrigdighaiqtyvegegygvvglrlmvitiepmvntgtwrmkmtayted gglscqyehslaigpriltsqgeelty
Timeline for d3tb5c_: