![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
![]() | Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) ![]() |
![]() | Family d.127.1.0: automated matches [194833] (1 protein) not a true family |
![]() | Protein automated matches [194834] (4 species) not a true protein |
![]() | Species Enterococcus faecalis [TaxId:565646] [194835] (1 PDB entry) |
![]() | Domain d3tb5b_: 3tb5 B: [194837] automated match to d1o0xa_ complexed with cit |
PDB Entry: 3tb5 (more details), 2.3 Å
SCOPe Domain Sequences for d3tb5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tb5b_ d.127.1.0 (B:) automated matches {Enterococcus faecalis [TaxId: 565646]} mitlkspreiemmdesgelladvhrhlrtfikpgitswdievfvrdfieshggvaaqigy egykyatccsindeichgfprkkvlkdgdlikvdmcvdlkgaisdscwsyvvgestpeid rlmevtkkalylgieqaqvgnrigdighaiqtyvegegygvvrdfvghgigptihespmi phygeagkglrlkegmvitiepmvntgtwrmkmdpngwtaytedgglscqyehslaitke gpriltsqgeelty
Timeline for d3tb5b_: