Lineage for d3tb5a_ (3tb5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974562Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2974563Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2974737Family d.127.1.0: automated matches [194833] (1 protein)
    not a true family
  6. 2974738Protein automated matches [194834] (4 species)
    not a true protein
  7. 2974739Species Enterococcus faecalis [TaxId:565646] [194835] (1 PDB entry)
  8. 2974740Domain d3tb5a_: 3tb5 A: [194838]
    automated match to d1o0xa_
    complexed with cit

Details for d3tb5a_

PDB Entry: 3tb5 (more details), 2.3 Å

PDB Description: Crystal Structure of the Enterococcus faecalis Methionine aminopeptidase apo form
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d3tb5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tb5a_ d.127.1.0 (A:) automated matches {Enterococcus faecalis [TaxId: 565646]}
mitlkspreiemmdesgelladvhrhlrtfikpgitswdievfvrdfieshggvaaqigy
egykyatccsindeichgfprkkvlkdgdlikvdmcvdlkgaisdscwsyvvgestpeid
rlmevtkkalylgieqaqvgnrigdighaiqtyvegegygvvrdfvghgigptihespmi
phygeagkglrlkegmvitiepmvntgtwrmkmdpngwtaytedgglscqyehslaitke
gpriltsqgeelty

SCOPe Domain Coordinates for d3tb5a_:

Click to download the PDB-style file with coordinates for d3tb5a_.
(The format of our PDB-style files is described here.)

Timeline for d3tb5a_: