SCOPe 2.07: Domain d4e0ha1: 4e0h A:86-188

Lineage for d4e0ha1 (4e0h A:86-188)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families)

5. Family a.24.15.0: automated matches [191449] (1 protein)
   not a true family

6. Protein automated matches [190684] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [194765] (3 PDB entries)

8. Domain d4e0ha1: 4e0h A:86-188 [194766]
   Other proteins in same PDB: d4e0ha2
   automated match to d1oqcb_
   complexed with fad

Details for d4e0ha1

PDB Entry: 4e0h, 2 Å

PDB Description: Crystal structure of FAD binding domain of Erv1 from Saccharomyces cerevisiae

PDB Compounds: (A:) Mitochondrial FAD-linked sulfhydryl oxidase ERV1

SCOPe Domain Sequences for d4e0ha1:

Sequence; same for both SEQRES and ATOM records:

>d4e0ha1 a.24.15.0 (A:86-188) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
dveqlgrsswtllhsvaasypaqptdqqkgemkqflnifshiypcnwcakdfekyirena
pqvesreelgrwmceahnkvnkklrkpkfdcnfwekrwkdgwd

Timeline for d4e0ha1:

• d4e0ha1 first appeared in SCOPe 2.02, called d4e0ha_
  
• d4e0ha1 appears in SCOPe 2.06
  
• d4e0ha1 appears in the current release, SCOPe 2.08