SCOPe 2.02: Domain d4e0ha_: 4e0h A:

Lineage for d4e0ha_ (4e0h A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families)

5. Family a.24.15.0: automated matches [191449] (1 protein)
   not a true family

6. Protein automated matches [190684] (2 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:559292] [194765] (2 PDB entries)

8. Domain d4e0ha_: 4e0h A: [194766]
   automated match to d1oqcb_
   complexed with fad

Details for d4e0ha_

PDB Entry: 4e0h, 2 Å

PDB Description: Crystal structure of FAD binding domain of Erv1 from Saccharomyces cerevisiae

PDB Compounds: (A:) Mitochondrial FAD-linked sulfhydryl oxidase ERV1

SCOPe Domain Sequences for d4e0ha_:

Sequence; same for both SEQRES and ATOM records:

>d4e0ha_ a.24.15.0 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
hmdveqlgrsswtllhsvaasypaqptdqqkgemkqflnifshiypcnwcakdfekyire
napqvesreelgrwmceahnkvnkklrkpkfdcnfwekrwkdgwd

Timeline for d4e0ha_:

• d4e0ha_ is new in SCOPe 2.02-stable
  
• d4e0ha_ appears in SCOPe 2.03
  
• d4e0ha_ appears in the current release, SCOPe 2.08, called d4e0ha1