| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) ![]() |
| Family a.24.15.0: automated matches [191449] (1 protein) not a true family |
| Protein automated matches [190684] (2 species) not a true protein |
| Species Saccharomyces cerevisiae [TaxId:559292] [194765] (2 PDB entries) |
| Domain d4e0ha_: 4e0h A: [194766] automated match to d1oqcb_ complexed with fad |
PDB Entry: 4e0h (more details), 2 Å
SCOPe Domain Sequences for d4e0ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e0ha_ a.24.15.0 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
hmdveqlgrsswtllhsvaasypaqptdqqkgemkqflnifshiypcnwcakdfekyire
napqvesreelgrwmceahnkvnkklrkpkfdcnfwekrwkdgwd
Timeline for d4e0ha_: