Lineage for d3ubta_ (3ubt A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893725Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 proteins)
    automatically mapped to Pfam PF00145
  6. 2893770Protein automated matches [190244] (3 species)
    not a true protein
  7. 2893771Species Haemophilus aegyptius [TaxId:197575] [194587] (1 PDB entry)
  8. 2893772Domain d3ubta_: 3ubt A: [194590]
    automated match to d1dcta_
    protein/DNA complex; complexed with 2pe, atp, cl; mutant

Details for d3ubta_

PDB Entry: 3ubt (more details), 2.5 Å

PDB Description: Crystal Structure of C71S Mutant of DNA Cytosine-5 Methyltransferase M.HaeIII Bound to DNA
PDB Compounds: (A:) Modification methylase HaeIII

SCOPe Domain Sequences for d3ubta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubta_ c.66.1.26 (A:) automated matches {Haemophilus aegyptius [TaxId: 197575]}
mnlislfsgaggldlgfqkagfriicaneydksiwktyesnhsaklikgdiskissdefp
kcdgiiggppsqswseggslrgiddprgklfyeyirilkqkkpifflaenvkgmmaqrhn
kavqefiqefdnagydvhiillnandygvaqdrkrvfyigfrkelninylppiphlikpt
fkdviwdlkdnpipaldknktngnkciypnheyfigsystifmsrnrvrqwnepaftvqa
sgrqcqlhpqapvmlkvsknlnkfvegkehlyrrltvrecarvqgfpddfifhyeslndg
ykmignavpvnlayeiaktiksaleick

SCOPe Domain Coordinates for d3ubta_:

Click to download the PDB-style file with coordinates for d3ubta_.
(The format of our PDB-style files is described here.)

Timeline for d3ubta_: