PDB entry 3ubt

View 3ubt on RCSB PDB site
Description: Crystal Structure of C71S Mutant of DNA Cytosine-5 Methyltransferase M.HaeIII Bound to DNA
Class: transferase/DNA
Keywords: Protein-DNA complex, DNA cytosine-5 methyltransferase, DNA binding, S-Adenosyl methionine binding, Cytosine-5 DNA methylation, TRANSFERASE-DNA complex
Deposited on 2011-10-24, released 2012-10-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-12-19, with a file datestamp of 2012-12-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.184
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Modification methylase HaeIII
    Species: Haemophilus aegyptius [TaxId:197575]
    Gene: haeIIIM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20589 (0-End)
      • engineered mutation (70)
    Domains in SCOPe 2.08: d3ubta_
  • Chain 'B':
    Compound: Modification methylase HaeIII
    Species: Haemophilus aegyptius [TaxId:197575]
    Gene: haeIIIM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20589 (0-End)
      • engineered mutation (70)
    Domains in SCOPe 2.08: d3ubtb_
  • Chain 'C':
    Compound: 5'-d(*tp*gp*gp*cp*cp*a)-3'
  • Chain 'D':
    Compound: 5'-d(*tp*gp*gp*cp*cp*a)-3'
  • Chain 'E':
    Compound: 5'-d(*tp*gp*gp*cp*cp*a)-3'
  • Chain 'F':
    Compound: 5'-d(*tp*gp*gp*cp*cp*a)-3'
  • Chain 'G':
    Compound: 5'-d(*tp*gp*gp*cp*cp*a)-3'
  • Chain 'H':
    Compound: 5'-d(*tp*gp*gp*cp*cp*a)-3'
  • Chain 'Y':
    Compound: Modification methylase HaeIII
    Species: Haemophilus aegyptius [TaxId:197575]
    Gene: haeIIIM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20589 (0-End)
      • engineered mutation (70)
    Domains in SCOPe 2.08: d3ubty_
  • Heterogens: CL, ATP, 2PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ubtA (A:)
    mnlislfsgaggldlgfqkagfriicaneydksiwktyesnhsaklikgdiskissdefp
    kcdgiiggppsqswseggslrgiddprgklfyeyirilkqkkpifflaenvkgmmaqrhn
    kavqefiqefdnagydvhiillnandygvaqdrkrvfyigfrkelninylppiphlikpt
    fkdviwdlkdnpipaldknktngnkciypnheyfigsystifmsrnrvrqwnepaftvqa
    sgrqcqlhpqapvmlkvsknlnkfvegkehlyrrltvrecarvqgfpddfifhyeslndg
    ykmignavpvnlayeiaktiksaleickgnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubtA (A:)
    mnlislfsgaggldlgfqkagfriicaneydksiwktyesnhsaklikgdiskissdefp
    kcdgiiggppsqswseggslrgiddprgklfyeyirilkqkkpifflaenvkgmmaqrhn
    kavqefiqefdnagydvhiillnandygvaqdrkrvfyigfrkelninylppiphlikpt
    fkdviwdlkdnpipaldknktngnkciypnheyfigsystifmsrnrvrqwnepaftvqa
    sgrqcqlhpqapvmlkvsknlnkfvegkehlyrrltvrecarvqgfpddfifhyeslndg
    ykmignavpvnlayeiaktiksaleick
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ubtB (B:)
    mnlislfsgaggldlgfqkagfriicaneydksiwktyesnhsaklikgdiskissdefp
    kcdgiiggppsqswseggslrgiddprgklfyeyirilkqkkpifflaenvkgmmaqrhn
    kavqefiqefdnagydvhiillnandygvaqdrkrvfyigfrkelninylppiphlikpt
    fkdviwdlkdnpipaldknktngnkciypnheyfigsystifmsrnrvrqwnepaftvqa
    sgrqcqlhpqapvmlkvsknlnkfvegkehlyrrltvrecarvqgfpddfifhyeslndg
    ykmignavpvnlayeiaktiksaleickgnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubtB (B:)
    mnlislfsgaggldlgfqkagfriicaneydksiwktyesnhsaklikgdiskissdefp
    kcdgiiggppsqswseggslrgiddprgklfyeyirilkqkkpifflaenvkgmmaqrhn
    kavqefiqefdnagydvhiillnandygvaqdrkrvfyigfrkelninylppiphlikpt
    fkdviwdlkdnpipaldknktngnkciypnheyfigsystifmsrnrvrqwnepaftvqa
    sgrqcqlhpqapvmlkvsknlnkfvegkehlyrrltvrecarvqgfpddfifhyeslndg
    ykmignavpvnlayeiaktiksaleick
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3ubtY (Y:)
    mnlislfsgaggldlgfqkagfriicaneydksiwktyesnhsaklikgdiskissdefp
    kcdgiiggppsqswseggslrgiddprgklfyeyirilkqkkpifflaenvkgmmaqrhn
    kavqefiqefdnagydvhiillnandygvaqdrkrvfyigfrkelninylppiphlikpt
    fkdviwdlkdnpipaldknktngnkciypnheyfigsystifmsrnrvrqwnepaftvqa
    sgrqcqlhpqapvmlkvsknlnkfvegkehlyrrltvrecarvqgfpddfifhyeslndg
    ykmignavpvnlayeiaktiksaleickgnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ubtY (Y:)
    mnlislfsgaggldlgfqkagfriicaneydksiwktyesnhsaklikgdiskissdefp
    kcdgiiggppsqswseggslrgiddprgklfyeyirilkqkkpifflaenvkgmmaqrhn
    kavqefiqefdnagydvhiillnandygvaqdrkrvfyigfrkelninylppiphlikpt
    fkdviwdlkdnpipaldknktngnkciypnheyfigsystifmsrnrvrqwnepaftvqa
    sgrqcqlhpqapvmlkvsknlnkfvegkehlyrrltvrecarvqgfpddfifhyeslndg
    ykmignavpvnlayeiaktiksaleick