SCOPe 2.08: Domain d3ug0a1: 3ug0 A:2-229

Lineage for d3ug0a1 (3ug0 A:2-229)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (6 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
   Uniprot P42212

8. Domain d3ug0a1: 3ug0 A:2-229 [194469]
   Other proteins in same PDB: d3ug0a2
   automated match to d2qu1a_

Details for d3ug0a1

PDB Entry: 3ug0, 2.09 Å

PDB Description: crystal structure of a trp-less green fluorescent protein translated by the simplified genetic code

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d3ug0a1:

Sequence; same for both SEQRES and ATOM records:

>d3ug0a1 d.22.1.1 (A:2-229) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelfagvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpfptlv
ttlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladh
yqqntpigdgpvllpdnhclstqtvlskdpnekrdhmvllefvtaagi

Timeline for d3ug0a1:

• d3ug0a1 first appeared in SCOPe 2.02, called d3ug0a_
  
• d3ug0a1 appears in SCOPe 2.07