| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
| Protein automated matches [190435] (12 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [193902] (7 PDB entries) |
| Domain d3vpnb1: 3vpn B:66-350 [193905] Other proteins in same PDB: d3vpna2, d3vpnb2 automated match to d2uw2a1 complexed with fe, mg; mutant |
PDB Entry: 3vpn (more details), 2.25 Å
SCOPe Domain Sequences for d3vpnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vpnb1 a.25.1.2 (B:66-350) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvedepllrenprrfvifpieyhdiwqmykkaeasfwtaedvdlskdiqhweslkpeery
fishvlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemysllidtyik
dpkereflfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasifw
lkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinavrieqeflt
ealpvkligmnctlmkqyiefvadrlmlelgfskvfrvenpfdfm
Timeline for d3vpnb1: