Lineage for d1e7ha2 (1e7h A:197-388)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6463Fold a.126: Serum albumin [48551] (1 superfamily)
  4. 6464Superfamily a.126.1: Serum albumin [48552] (1 family) (S)
  5. 6465Family a.126.1.1: Serum albumin [48553] (1 protein)
  6. 6466Protein Serum albumin [48554] (1 species)
  7. 6467Species Human (Homo sapiens) [TaxId:9606] [48555] (13 PDB entries)
  8. 6487Domain d1e7ha2: 1e7h A:197-388 [19367]

Details for d1e7ha2

PDB Entry: 1e7h (more details), 2.43 Å

PDB Description: human serum albumin complexed with hexadecanoic acid (palmitic acid)

SCOP Domain Sequences for d1e7ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7ha2 a.126.1.1 (A:197-388) Serum albumin {Human (Homo sapiens)}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

SCOP Domain Coordinates for d1e7ha2:

Click to download the PDB-style file with coordinates for d1e7ha2.
(The format of our PDB-style files is described here.)

Timeline for d1e7ha2: