![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein automated matches [190118] (16 species) not a true protein |
![]() | Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [193323] (2 PDB entries) |
![]() | Domain d4gswa1: 4gsw A:4-75 [193324] Other proteins in same PDB: d4gswa2 automated match to d3nheb_ complexed with so4 |
PDB Entry: 4gsw (more details), 2.15 Å
SCOPe Domain Sequences for d4gswa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gswa1 d.15.1.1 (A:4-75) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} mqifvktltgktitlevepndsidaikakiqekegippdqqrlifagkqleegktlsdyn iqkestlhlvlr
Timeline for d4gswa1: