Lineage for d4gswa1 (4gsw A:4-75)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932439Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [193323] (2 PDB entries)
  8. 2932441Domain d4gswa1: 4gsw A:4-75 [193324]
    Other proteins in same PDB: d4gswa2
    automated match to d3nheb_
    complexed with so4

Details for d4gswa1

PDB Entry: 4gsw (more details), 2.15 Å

PDB Description: Crystal structure of ubiquitin from Entamoeba histolytica to 2.15 Angstrom
PDB Compounds: (A:) Ubiquitin

SCOPe Domain Sequences for d4gswa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gswa1 d.15.1.1 (A:4-75) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
mqifvktltgktitlevepndsidaikakiqekegippdqqrlifagkqleegktlsdyn
iqkestlhlvlr

SCOPe Domain Coordinates for d4gswa1:

Click to download the PDB-style file with coordinates for d4gswa1.
(The format of our PDB-style files is described here.)

Timeline for d4gswa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gswa2
View in 3D
Domains from other chains:
(mouse over for more information)
d4gswb_