PDB entry 4gsw

View 4gsw on RCSB PDB site
Description: Crystal structure of ubiquitin from Entamoeba histolytica to 2.15 Angstrom
Class: protein binding
Keywords: ubiquitin, ubiquitin-like modifier, ubiquitin fold, post-translational modification, EhUbc5, EhUba1, ubiquitination, isopeptide bond, PROTEIN BINDING
Deposited on 2012-08-28, released 2012-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.199
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhUBI1, EHI_083270, EHI_083410, EHI_156660, EHI_178340
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4M760 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.08: d4gswa1, d4gswa2
  • Chain 'B':
    Compound: Ubiquitin
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: EhUBI1, EHI_083270, EHI_083410, EHI_156660, EHI_178340
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4gswb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4gswA (A:)
    snamqifvktltgktitlevepndsidaikakiqekegippdqqrlifagkqleegktls
    dyniqkestlhlvlrlrggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gswA (A:)
    namqifvktltgktitlevepndsidaikakiqekegippdqqrlifagkqleegktlsd
    yniqkestlhlvlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4gswB (B:)
    snamqifvktltgktitlevepndsidaikakiqekegippdqqrlifagkqleegktls
    dyniqkestlhlvlrlrggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4gswB (B:)
    mqifvktltgktitlevepndsidaikakiqekegippdqqrlifagkqleegktlsdyn
    iqkestlhlvlrl