Lineage for d4ge1a_ (4ge1 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805574Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2805575Protein automated matches [190698] (25 species)
    not a true protein
  7. 2805735Species Rhodnius prolixus [TaxId:13249] [193297] (10 PDB entries)
  8. 2805743Domain d4ge1a_: 4ge1 A: [193298]
    automated match to d2eu7x_
    complexed with gol, tss

Details for d4ge1a_

PDB Entry: 4ge1 (more details), 2.15 Å

PDB Description: structure of the tryptamine complex of the amine binding protein of rhodnius prolixus
PDB Compounds: (A:) Biogenic amine-binding protein

SCOPe Domain Sequences for d4ge1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ge1a_ b.60.1.0 (A:) automated matches {Rhodnius prolixus [TaxId: 13249]}
sgcstvdtvkdfnkdnfftgswyithyklgdstlevgdknctkflhqktadgkikevfsn
ynpnaktysydisfakvsdfdgnngkytaknvivekdgrkidertlqvsyidtdyskysv
vhvcdpaapdyylyavqsrtenvkedvkskveaalgkvglklsglfdattlgnkcqydde
tlqkllkqsfpnyek

SCOPe Domain Coordinates for d4ge1a_:

Click to download the PDB-style file with coordinates for d4ge1a_.
(The format of our PDB-style files is described here.)

Timeline for d4ge1a_: