![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
![]() | Protein automated matches [190698] (25 species) not a true protein |
![]() | Species Rhodnius prolixus [TaxId:13249] [193297] (10 PDB entries) |
![]() | Domain d4ge1b_: 4ge1 B: [202246] automated match to d4ge1a_ complexed with gol, tss |
PDB Entry: 4ge1 (more details), 2.15 Å
SCOPe Domain Sequences for d4ge1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ge1b_ b.60.1.0 (B:) automated matches {Rhodnius prolixus [TaxId: 13249]} sgcstvdtvkdfnkdnfftgswyithyklgdstlevgdknctkflhqktadgkikevfsn ynpnaktysydisfakvsdfdgnngkytaknvivekdgrkidertlqvsyidtdyskysv vhvcdpaapdyylyavqsrtenvkedvkskveaalgkvglklsglfdattlgnkcqydde tlqkllkqsfpnye
Timeline for d4ge1b_: