Lineage for d1a28b_ (1a28 B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) 
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (12 proteins) 
Protein Progesterone receptor [48517] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48518] (1 PDB entry) 
Domain d1a28b_: 1a28 B: [19291]
Details for d1a28b_
PDB Entry: 1a28 (more details), 1.8 Å
PDB Description: hormone-bound human progesterone receptor ligand-binding domain
SCOP Domain Sequences for d1a28b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a28b_ a.123.1.1 (B:) Progesterone receptor {Human (Homo sapiens)}
lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
gmvkpllfh
SCOP Domain Coordinates for d1a28b_:
Click to download the PDB-style file with coordinates for d1a28b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a28b_:
- d1a28b_ appears in SCOP 1.57
- d1a28b_ appears in the current release, SCOPe 2.08
View in 3D
