SCOPe 2.04: Domain d4f7id_: 4f7i D:

Lineage for d4f7id_ (4f7i D:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (18 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [192453] (1 PDB entry)

8. Domain d4f7id_: 4f7i D: [192424]
   automated match to d1xaaa_
   complexed with eoh, gol, ipm, k, mn, mpo, nad

Details for d4f7id_

PDB Entry: 4f7i, 2 Å

PDB Description: structure of isopropylmalate dehydrogenase from thermus thermophilus in complex with ipm, mn and nadh

PDB Compounds: (D:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d4f7id_:

Sequence; same for both SEQRES and ATOM records:

>d4f7id_ c.77.1.1 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
smkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrk
gveeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplk
eeiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkh
vvsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnif
gdilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammle
hafglvelarkvedavakalletpppdlggsagteaftatvlrhlaaaa

Timeline for d4f7id_:

• d4f7id_ first appeared in SCOPe 2.02
  
• d4f7id_ appears in SCOPe 2.03
  
• d4f7id_ appears in SCOPe 2.05
  
• d4f7id_ appears in the current release, SCOPe 2.08, called d4f7id1