Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
Protein automated matches [190072] (22 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [192453] (1 PDB entry) |
Domain d4f7id1: 4f7i D:1-345 [192424] Other proteins in same PDB: d4f7ia2, d4f7ia3, d4f7ib2, d4f7ib3, d4f7ic2, d4f7ic3, d4f7id2, d4f7id3 automated match to d1xaaa_ complexed with eoh, gol, ipm, k, mn, mpo, nad |
PDB Entry: 4f7i (more details), 2 Å
SCOPe Domain Sequences for d4f7id1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f7id1 c.77.1.1 (D:1-345) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhv vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh afglvelarkvedavakalletpppdlggsagteaftatvlrhla
Timeline for d4f7id1: