SCOPe 2.02: Domain d4efsa_: 4efs A:

Lineage for d4efsa_ (4efs A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein automated matches [190182] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186920] (16 PDB entries)

8. Domain d4efsa_: 4efs A: [192377]
   automated match to d1os9a_
   complexed with ca, e37, edo, gol, imd, pgo, pgr, zn

Details for d4efsa_

PDB Entry: 4efs, 1.63 Å

PDB Description: Human MMP12 in complex with L-glutamate motif inhibitor

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d4efsa_:

Sequence; same for both SEQRES and ATOM records:

>d4efsa_ d.92.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
glghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d4efsa_:

• d4efsa_ is new in SCOPe 2.02-stable
  
• d4efsa_ appears in SCOPe 2.03
  
• d4efsa_ appears in the current release, SCOPe 2.08, called d4efsa1