PDB entry 4efs

View 4efs on RCSB PDB site
Description: Human MMP12 in complex with L-glutamate motif inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: pseudo peptides, potent inhibitors, METZINCIN, Zinc protease, L-glutamate motif inhibitors, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-03-30, released 2012-06-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.156
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: HME, MMP12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • initiating methionine (0)
      • engineered mutation (66)
    Domains in SCOPe 2.02: d4efsa_
  • Heterogens: ZN, CA, E37, GOL, EDO, PGR, PGO, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4efsA (A:)
mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
glghssdpkavmfptykyvdintfrlsaddirgiqslyg