Lineage for d4acac4 (4aca C:1-179)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867134Protein Elongation factor SelB, N-terminal domain [117537] (1 species)
  7. 2867135Species Methanococcus maripaludis [TaxId:39152] [117538] (3 PDB entries)
    Uniprot Q8J307
  8. 2867142Domain d4acac4: 4aca C:1-179 [192272]
    Other proteins in same PDB: d4acaa1, d4acaa2, d4acaa3, d4acaa5, d4acab1, d4acab2, d4acab3, d4acac1, d4acac2, d4acac3, d4acac5, d4acad1, d4acad2, d4acad3
    complexed with 5gp, dxc, so4

Details for d4acac4

PDB Entry: 4aca (more details), 3.15 Å

PDB Description: crystal structure of translation elongation factor selb from methanococcus maripaludis, apo form
PDB Compounds: (C:) translation elongation factor selb

SCOPe Domain Sequences for d4acac4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4acac4 c.37.1.8 (C:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]}
mdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyr
itlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitk
sdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii

SCOPe Domain Coordinates for d4acac4:

Click to download the PDB-style file with coordinates for d4acac4.
(The format of our PDB-style files is described here.)

Timeline for d4acac4: