![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Elongation factor SelB, N-terminal domain [117537] (1 species) |
![]() | Species Methanococcus maripaludis [TaxId:39152] [117538] (3 PDB entries) Uniprot Q8J307 |
![]() | Domain d4acac4: 4aca C:1-179 [192272] Other proteins in same PDB: d4acaa1, d4acaa2, d4acaa3, d4acaa5, d4acab1, d4acab2, d4acab3, d4acac1, d4acac2, d4acac3, d4acac5, d4acad1, d4acad2, d4acad3 complexed with 5gp, dxc, so4 |
PDB Entry: 4aca (more details), 3.15 Å
SCOPe Domain Sequences for d4acac4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4acac4 c.37.1.8 (C:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} mdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyr itlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitk sdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii
Timeline for d4acac4:
![]() Domains from same chain: (mouse over for more information) d4acac1, d4acac2, d4acac3, d4acac5 |