SCOPe 2.08: Domain d3umra2: 3umr A:8-60,A:182-354

Lineage for d3umra2 (3umr A:8-60,A:182-354)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Human (Homo sapiens) [TaxId:9606] [159560] (9 PDB entries)

8. Domain d3umra2: 3umr A:8-60,A:182-354 [192179]
   Other proteins in same PDB: d3umra1
   complexed with cl, gdp, gol, so4; mutant
   has additional subdomain(s) that are not in the common domain

Details for d3umra2

PDB Entry: 3umr, 2.04 Å

PDB Description: Crystal structure of the G202D mutant of human G-alpha-i1

PDB Compounds: (A:) Guanine nucleotide-binding protein G(i) subunit alpha-1

SCOPe Domain Sequences for d3umra2:

Sequence, based on SEQRES records:

>d3umra2 c.37.1.8 (A:8-60,A:182-354) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
edkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgivet
hftfkdlhfkmfdvdgqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesm
klfdsicnnkcftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqf
edlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf

Sequence, based on observed residues (ATOM records):

>d3umra2 c.37.1.8 (A:8-60,A:182-354) Transducin (alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
edkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagXtgivet
hftfkdlhfkmfdvdfegvtaiifcvalsdydlveemnrmhesmklfdsicnnkcftdts
iilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythf
tcatdtknvqfvfdavtdviiknnlkdcglf

Timeline for d3umra2:

• d3umra2 first appeared in SCOPe 2.02
  
• d3umra2 appears in SCOPe 2.07