Class a: All alpha proteins [46456] (285 folds) |
Superfamily a.118.8: TPR-like [48452] (9 families) |
Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
Protein Protein phosphatase 5 [48454] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48455] (3 PDB entries) |
Domain d1a17a_: 1a17 A: [19206] complexed with so4 |
PDB Entry: 1a17 (more details), 2.45 Å
SCOPe Domain Sequences for d1a17a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} ppadgalkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecy gyalgdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqe cnkivkqkaferaiagdehkrsvvdsldiesmtiedeys
Timeline for d1a17a_: