Lineage for d1a17__ (1a17 -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6222Superfamily a.118.8: Tetratricopeptide repeat (TPR) [48452] (1 family) (S)
  5. 6223Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (5 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 6236Protein Protein phosphatase 5 [48454] (1 species)
  7. 6237Species Human (Homo sapiens) [TaxId:9606] [48455] (1 PDB entry)
  8. 6238Domain d1a17__: 1a17 - [19206]

Details for d1a17__

PDB Entry: 1a17 (more details), 2.45 Å

PDB Description: tetratricopeptide repeats of protein phosphatase 5

SCOP Domain Sequences for d1a17__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a17__ a.118.8.1 (-) Protein phosphatase 5 {Human (Homo sapiens)}
ppadgalkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecy
gyalgdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqe
cnkivkqkaferaiagdehkrsvvdsldiesmtiedeys

SCOP Domain Coordinates for d1a17__:

Click to download the PDB-style file with coordinates for d1a17__.
(The format of our PDB-style files is described here.)

Timeline for d1a17__: