Lineage for d1a4oc_ (1a4o C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007216Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2007217Family a.118.7.1: 14-3-3 protein [48446] (5 protein domains)
  6. 2007236Protein zeta isoform [48449] (2 species)
  7. 2007237Species Cow (Bos taurus) [TaxId:9913] [48450] (3 PDB entries)
  8. 2007240Domain d1a4oc_: 1a4o C: [19196]

Details for d1a4oc_

PDB Entry: 1a4o (more details), 2.8 Å

PDB Description: 14-3-3 protein zeta isoform
PDB Compounds: (C:) 14-3-3 protein zeta

SCOPe Domain Sequences for d1a4oc_:

Sequence, based on SEQRES records: (download)

>d1a4oc_ a.118.7.1 (C:) zeta isoform {Cow (Bos taurus) [TaxId: 9913]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlw

Sequence, based on observed residues (ATOM records): (download)

>d1a4oc_ a.118.7.1 (C:) zeta isoform {Cow (Bos taurus) [TaxId: 9913]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqkekkqqmareyrekietelrdicndvlsllekflipnaaeskvfylkmkgdyy
rylaevaagddkkgivdqsqqayqeafeiskkemirlglalnfsvfyyacslaktafdea
iaellimqllrdnltlw

SCOPe Domain Coordinates for d1a4oc_:

Click to download the PDB-style file with coordinates for d1a4oc_.
(The format of our PDB-style files is described here.)

Timeline for d1a4oc_: