PDB entry 1a4o

View 1a4o on RCSB PDB site
Description: 14-3-3 protein zeta isoform
Class: signal transduction
Keywords: signal transduction
Deposited on 1998-02-01, released 1999-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.31
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein zeta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a4oa_
  • Chain 'B':
    Compound: 14-3-3 protein zeta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a4ob_
  • Chain 'C':
    Compound: 14-3-3 protein zeta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a4oc_
  • Chain 'D':
    Compound: 14-3-3 protein zeta
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a4od_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a4oA (A:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtsdtqgdeaeag
    eggen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a4oA (A:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqkekkqqmareyrekietelrdicndvlsllekflipnaaeskvfylkmkgdyy
    rylaevaagddkkgivdqsqqayqeafeiskkemirlglalnfsvfyyacslaktafdea
    iaellimqllrdnltlw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a4oB (B:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtsdtqgdeaeag
    eggen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a4oB (B:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqkekkqqmareyrekietelrdicndvlsllekflipnaaeskvfylkmkgdyy
    rylaevaagddkkgivdqsqqayqeafeiskkemirlglalnfsvfyyacslaktafdea
    iaellimqllrdnltlw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1a4oC (C:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtsdtqgdeaeag
    eggen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a4oC (C:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqkekkqqmareyrekietelrdicndvlsllekflipnaaeskvfylkmkgdyy
    rylaevaagddkkgivdqsqqayqeafeiskkemirlglalnfsvfyyacslaktafdea
    iaellimqllrdnltlw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1a4oD (D:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwtsdtqgdeaeag
    eggen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a4oD (D:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqkekkqqmareyrekietelrdicndvlsllekflipnaaeskvfylkmkgdyy
    rylaevaagddkkgivdqsqqayqeafeiskkemirlglalnfsvfyyacslaktafdea
    iaellimqllrdnltlw