SCOPe 2.06: Domain d1dc2a_: 1dc2 A:

Lineage for d1dc2a_ (1dc2 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein Cell cycle inhibitor p16ink4A [48414] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48415] (4 PDB entries)

8. Domain d1dc2a_: 1dc2 A: [19168]

Details for d1dc2a_

PDB Entry: 1dc2

PDB Description: solution nmr structure of tumor suppressor p16ink4a, 20 structures

PDB Compounds: (A:) cyclin-dependent kinase 4 inhibitor a (p16ink4a)

SCOPe Domain Sequences for d1dc2a_:

Sequence; same for both SEQRES and ATOM records:

>d1dc2a_ d.211.1.1 (A:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]}
mepaagssmepsadwlataaargrveevralleagalpnapnsygrrpiqvmmmgsarva
ellllhgaepncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaee
lghrdvarylraaaggtrgsnharidaaegpsdipd

Timeline for d1dc2a_:

• d1dc2a_ first appeared (with stable ids) in SCOP 1.55
  
• d1dc2a_ appears in SCOPe 2.05
  
• d1dc2a_ appears in SCOPe 2.07
  
• d1dc2a_ appears in the current release, SCOPe 2.08