SCOP 1.61: Domain d1bd8__: 1bd8 -

Lineage for d1bd8__ (1bd8 -)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)

4. Superfamily d.211.1: Ankyrin repeat [48403] (1 family)

5. Family d.211.1.1: Ankyrin repeat [48404] (10 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein Cell cycle inhibitor p19ink4D [48409] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48410] (2 PDB entries)

8. Domain d1bd8__: 1bd8 - [19157]

Details for d1bd8__

PDB Entry: 1bd8, 1.8 Å

PDB Description: structure of cdk inhibitor p19ink4d

SCOP Domain Sequences for d1bd8__:

Sequence; same for both SEQRES and ATOM records:

>d1bd8__ d.211.1.1 (-) Cell cycle inhibitor p19ink4D {Human (Homo sapiens)}
ragdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgstaialellkqgas
pnvqdtsgtspvhdaartgfldtlkvlvehgadvnvpdgtgalpihlavqeghtavvsfl
aaesdlhrrdargltplelalqrgaqdlvdilqghm

Timeline for d1bd8__:

• d1bd8__ first appeared (with stable ids) in SCOP 1.55
  
• d1bd8__ appears in SCOP 1.59
  
• d1bd8__ appears in SCOP 1.63
  
• d1bd8__ appears in the current release, SCOPe 2.08, called d1bd8a_