Lineage for d1bd8__ (1bd8 -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies) 
Superfamily a.118.2: Ankyrin repeat [48403] (1 family) 
Family a.118.2.1: Ankyrin repeat [48404] (9 proteins) Protein Cell cycle inhibitor p19ink4D [48409] (2 species) Species Human (Homo sapiens) [TaxId:9606] [48410] (2 PDB entries) 
Domain d1bd8__: 1bd8 - [19157]
Details for d1bd8__
PDB Entry: 1bd8 (more details), 1.8 Å
PDB Description: structure of cdk inhibitor p19ink4d
SCOP Domain Sequences for d1bd8__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bd8__ a.118.2.1 (-) Cell cycle inhibitor p19ink4D {Human (Homo sapiens)}
ragdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgstaialellkqgas
pnvqdtsgtspvhdaartgfldtlkvlvehgadvnvpdgtgalpihlavqeghtavvsfl
aaesdlhrrdargltplelalqrgaqdlvdilqghm
SCOP Domain Coordinates for d1bd8__:
Click to download the PDB-style file with coordinates for d1bd8__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bd8__:
- d1bd8__ appears in SCOP 1.57
- d1bd8__ appears in the current release, SCOPe 2.08, called d1bd8a_
View in 3D