![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
![]() | Superfamily d.211.1: Ankyrin repeat [48403] (2 families) ![]() repeats organized in elongated structures |
![]() | Family d.211.1.1: Ankyrin repeat [48404] (21 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
![]() | Protein Cell cycle inhibitor p19ink4D [48409] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48410] (2 PDB entries) |
![]() | Domain d1bd8a_: 1bd8 A: [19157] |
PDB Entry: 1bd8 (more details), 1.8 Å
SCOPe Domain Sequences for d1bd8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} ragdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgstaialellkqgas pnvqdtsgtspvhdaartgfldtlkvlvehgadvnvpdgtgalpihlavqeghtavvsfl aaesdlhrrdargltplelalqrgaqdlvdilqghm
Timeline for d1bd8a_: