Lineage for d1he8a1 (1he8 A:525-725)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100538Fold a.118: alpha-alpha superhelix [48370] (13 superfamilies)
  4. 100539Superfamily a.118.1: ARM repeat [48371] (9 families) (S)
  5. 100624Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain
  6. 100625Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 100626Species Human (Homo sapiens) [TaxId:9606] [48402] (3 PDB entries)
  8. 100629Domain d1he8a1: 1he8 A:525-725 [19154]
    Other proteins in same PDB: d1he8a2, d1he8a3, d1he8a4, d1he8b_

Details for d1he8a1

PDB Entry: 1he8 (more details), 3 Å

PDB Description: ras g12v - pi 3-kinase gamma complex

SCOP Domain Sequences for d1he8a1:

Sequence, based on SEQRES records: (download)

>d1he8a1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens)}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d1he8a1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens)}
hpisaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsa
larfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcg

SCOP Domain Coordinates for d1he8a1:

Click to download the PDB-style file with coordinates for d1he8a1.
(The format of our PDB-style files is described here.)

Timeline for d1he8a1: