SCOPe 2.08: Domain d1he8a1: 1he8 A:525-725

Lineage for d1he8a1 (1he8 A:525-725)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
   automatically mapped to Pfam PF00613
   this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain

6. Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48402] (77 PDB entries)

8. Domain d1he8a1: 1he8 A:525-725 [19154]
   Other proteins in same PDB: d1he8a2, d1he8a3, d1he8a4, d1he8b_
   complexed with gnp, mg
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1he8a1

PDB Entry: 1he8, 3 Å

PDB Description: ras g12v - pi 3-kinase gamma complex

PDB Compounds: (A:) phosphatidylinositol 3-kinase catalytic subunit, gamma isoform

SCOPe Domain Sequences for d1he8a1:

Sequence, based on SEQRES records:

>d1he8a1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records):

>d1he8a1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
hpisaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsa
larfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcg

Timeline for d1he8a1:

• d1he8a1 first appeared (with stable ids) in SCOP 1.55
  
• d1he8a1 appears in SCOPe 2.07