SCOP 1.59: Domain d1he8a3: 1he8 A:144-321

Lineage for d1he8a3 (1he8 A:144-321)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.1: Ubiquitin-like [54236] (5 families)

5. Family d.15.1.5: Ras-binding domain, RBD [54263] (6 proteins)

6. Protein Phoshoinositide 3-kinase (PI3K) [54274] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54276] (3 PDB entries)

8. Domain d1he8a3: 1he8 A:144-321 [37637]
   Other proteins in same PDB: d1he8a1, d1he8a2, d1he8a4, d1he8b_

Details for d1he8a3

PDB Entry: 1he8, 3 Å

PDB Description: ras g12v - pi 3-kinase gamma complex

SCOP Domain Sequences for d1he8a3:

Sequence; same for both SEQRES and ATOM records:

>d1he8a3 d.15.1.5 (A:144-321) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens)}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifikihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Timeline for d1he8a3:

• d1he8a3 first appeared (with stable ids) in SCOP 1.55
  
• d1he8a3 appears in SCOP 1.57
  
• d1he8a3 appears in SCOP 1.61
  
• d1he8a3 appears in the current release, SCOPe 2.08