![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (26 families) ![]() |
![]() | Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein) automatically mapped to Pfam PF00613 this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain |
![]() | Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [48401] (6 PDB entries) |
![]() | Domain d1e7ua1: 1e7u A:525-725 [19147] Other proteins in same PDB: d1e7ua2, d1e7ua3, d1e7ua4, d1e7ua5 complexed with kwt |
PDB Entry: 1e7u (more details), 2 Å
SCOPe Domain Sequences for d1e7ua1:
Sequence, based on SEQRES records: (download)
>d1e7ua1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Pig (Sus scrofa) [TaxId: 9823]} hpialpkhrptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk dpkaypklfssvkwgqqeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraia vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia qsrhyqqrfavileaylrgcg
>d1e7ua1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Pig (Sus scrofa) [TaxId: 9823]} hpialpkhrptdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslkdpkay pklfssvkwgqqeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraiavqkle sledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhy qqrfavileaylrgcg
Timeline for d1e7ua1:
![]() Domains from same chain: (mouse over for more information) d1e7ua2, d1e7ua3, d1e7ua4, d1e7ua5 |