PDB entry 1e7u

View 1e7u on RCSB PDB site
Description: structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine
Class: phosphoinositide 3-kinase gamma
Keywords: phosphoinositide 3-kinase gamma, secondary messenger generation, pi3k, pi 3k, wortmannin
Deposited on 2000-09-08, released 2000-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.254
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol 3-kinase catalytic subunit
    Species: SUS SCROFA [TaxId:9823]
    Gene: P120S144C
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02697
      • expression tag (1)
      • conflict (363)
    Domains in SCOPe 2.06: d1e7ua1, d1e7ua2, d1e7ua3, d1e7ua4, d1e7ua5
  • Heterogens: KWT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e7uA (A:)
    aaseetlafqrqlnaligydvtdvsnvhddeleftrrrlvtprmaevagrdpklyamhpw
    vtskplpeyllkkitnncvfivihrsttsqtikvsaddtpgtilqsfftkmakkkslmdi
    pesqnerdfvlrvcgrdeylvgetpiknfqwvrqclkngeeihlvldtppdpaldevrke
    ewplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprtadltv
    fveaniqygqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgakpal
    sgktsaempspeskgkaqllyyvnlllidhrfllrhgeyvlhmwqlsgkgedqgsfnadk
    ltsatnpdkensmsisilldnychpialpkhrptpdpegdrvraempnqlrkqleaiiat
    dplnpltaedkellwhfryeslkdpkaypklfssvkwgqqeivaktyqllakrevwdqsa
    ldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfl
    lkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvidm
    lqkvtidikslsaekydvssqvisqlkqklenlqnlnlpqsfrvpydpglkagalviekc
    kvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesld
    lcllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlshwlkekcpieekf
    qaaverfvyscagycvatfvlgigdrhndnimisetgnlfhidfghilgnyksflginke
    rvpfvltpdflfvmgtsgkktslhfqkfqdvcvkaylalrhhtnlliilfsmmlmtgmpq
    ltskedieyirdaltvgkseedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhs
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e7uA (A:)
    aseetlafqrqlnaligydvtdvsnvhddeleftrrrlvtprmaevagrdpklyamhpwv
    tskplpeyllkkitnncvfivihrsttsqtikvsaddtpgtilqsfftkmaknerdfvlr
    vcgrdeylvgetpiknfqwvrqclkngeeihlvldtppdpaldevrketvslwdcdrkfr
    vkirgidipvlprtadltvfveaniqygqqvlcqrrtspkpfteevlwnvwlefsikikd
    lpkgallnlqiycgakqllyyvnlllidhrfllrhgeyvlhmwqlsgkgfnadkltsatn
    pdkensmsisilldnychpialpkhrptdrvraempnqlrkqleaiiatdplnpltaedk
    ellwhfryeslkdpkaypklfssvkwgqqeivaktyqllakrevwdqsaldvgltmqlld
    cnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrig
    hflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvidmlqkvtidiksl
    saekydvssqvisqlkqklenlqnlnlpqsfrvpydpglkagalviekckvmaskkkplw
    lefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldlcllpygcist
    gdkigmieivkdattiakiqqstvgntgafkdevlshwlkekcpieekfqaaverfvysc
    agycvatfvlgigdrhndnimisetgnlfhidfghinkervpfvltpdflfvmgtsgkkt
    slhfqkfqdvcvkaylalrhhtnlliilfsmmlmtgmpqltskedieyirdaltvgksee
    dakkyfldqievcrdkgwtvqfnwflhlvlgi