Lineage for d1e7ua1 (1e7u A:525-725)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2332885Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
  6. 2332886Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 2332954Species Pig (Sus scrofa) [TaxId:9823] [48401] (6 PDB entries)
  8. 2332955Domain d1e7ua1: 1e7u A:525-725 [19147]
    Other proteins in same PDB: d1e7ua2, d1e7ua3, d1e7ua4, d1e7ua5
    complexed with kwt

Details for d1e7ua1

PDB Entry: 1e7u (more details), 2 Å

PDB Description: structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine
PDB Compounds: (A:) phosphatidylinositol 3-kinase catalytic subunit

SCOPe Domain Sequences for d1e7ua1:

Sequence, based on SEQRES records: (download)

>d1e7ua1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Pig (Sus scrofa) [TaxId: 9823]}
hpialpkhrptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
dpkaypklfssvkwgqqeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d1e7ua1 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Pig (Sus scrofa) [TaxId: 9823]}
hpialpkhrptdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslkdpkay
pklfssvkwgqqeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraiavqkle
sledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhy
qqrfavileaylrgcg

SCOPe Domain Coordinates for d1e7ua1:

Click to download the PDB-style file with coordinates for d1e7ua1.
(The format of our PDB-style files is described here.)

Timeline for d1e7ua1: