Lineage for d1io7a_ (1io7 A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily) Superfamily a.104.1: Cytochrome P450 [48264] (1 family) 
Family a.104.1.1: Cytochrome P450 [48265] (8 proteins) 
Protein CYP119 [48278] (1 species) Species Sulfolobus solfataricus [TaxId:2287] [48279] (3 PDB entries) 
Domain d1io7a_: 1io7 A: [18971]
Details for d1io7a_
PDB Entry: 1io7 (more details), 1.5 Å
PDB Description: thermophilic cytochrome p450 (cyp119) from sulfolobus solfataricus: high resolution structural origin of its thermostability and functional properties
SCOP Domain Sequences for d1io7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1io7a_ a.104.1.1 (A:) CYP119 {Sulfolobus solfataricus}
mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
vvrlks
SCOP Domain Coordinates for d1io7a_:
Click to download the PDB-style file with coordinates for d1io7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1io7a_:
- d1io7a_ appears in SCOP 1.57
- d1io7a_ appears in the current release, SCOPe 2.08
View in 3D
