Lineage for d1qnf_1 (1qnf 205-475)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284111Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 284112Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (1 family) (S)
  5. 284113Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (2 proteins)
  6. 284114Protein C-terminal domain of DNA photolyase [48175] (3 species)
    N-terminal domain is alpha/beta and binds a light-harvesting cofactor
  7. 284115Species Anacystis nidulans [48177] (1 PDB entry)
  8. 284116Domain d1qnf_1: 1qnf 205-475 [18777]
    Other proteins in same PDB: d1qnf_2
    complexed with fad, hdf

Details for d1qnf_1

PDB Entry: 1qnf (more details), 1.8 Å

PDB Description: structure of photolyase

SCOP Domain Sequences for d1qnf_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnf_1 a.99.1.1 (205-475) C-terminal domain of DNA photolyase {Anacystis nidulans}
pvepgetaaiarlqefcdraiadydpqrnfpaeagtsglspalkfgaigirqawqaasaa
halsrsdearnsirvwqqelawrefyqhalyhfpsladgpyrslwqqfpwenrealftaw
tqaqtgypivdaamrqltetgwmhnrcrmivasfltkdliidwrrgeqffmqhlvdgdla
annggwqwsassgmdpkplrifnpasqakkfdatatyikrwlpelrhvhpkdlisgeitp
ierrgypapivnhnlrqkqfkalynqlkaai

SCOP Domain Coordinates for d1qnf_1:

Click to download the PDB-style file with coordinates for d1qnf_1.
(The format of our PDB-style files is described here.)

Timeline for d1qnf_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qnf_2