Lineage for d1qnf_1 (1qnf 205-475)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.99: FAD-binding (C-terminal) domain of DNA photolyase [48172] (1 superfamily) Superfamily a.99.1: FAD-binding (C-terminal) domain of DNA photolyase [48173] (1 family) 
Family a.99.1.1: FAD-binding (C-terminal) domain of DNA photolyase [48174] (1 protein) Protein FAD-binding (C-terminal) domain of DNA photolyase [48175] (2 species) Species Anacystis nidulans [48177] (1 PDB entry) 
Domain d1qnf_1: 1qnf 205-475 [18777]
Other proteins in same PDB: d1qnf_2
Details for d1qnf_1
PDB Entry: 1qnf (more details), 1.8 Å
PDB Description: structure of photolyase
SCOP Domain Sequences for d1qnf_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qnf_1 a.99.1.1 (205-475) FAD-binding (C-terminal) domain of DNA photolyase {Anacystis nidulans}
pvepgetaaiarlqefcdraiadydpqrnfpaeagtsglspalkfgaigirqawqaasaa
halsrsdearnsirvwqqelawrefyqhalyhfpsladgpyrslwqqfpwenrealftaw
tqaqtgypivdaamrqltetgwmhnrcrmivasfltkdliidwrrgeqffmqhlvdgdla
annggwqwsassgmdpkplrifnpasqakkfdatatyikrwlpelrhvhpkdlisgeitp
ierrgypapivnhnlrqkqfkalynqlkaai
SCOP Domain Coordinates for d1qnf_1:
Click to download the PDB-style file with coordinates for d1qnf_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qnf_1:
- d1qnf_1 appears in SCOP 1.57
- d1qnf_1 appears in the current release, SCOPe 2.08, called d1qnfa1
View in 3D
