Lineage for d1qnfa1 (1qnf A:205-475)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) (S)
    automatically mapped to Pfam PF03441
  5. Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (3 proteins)
  6. Protein C-terminal domain of DNA photolyase [48175] (3 species)
    N-terminal domain is alpha/beta and binds a light-harvesting cofactor
  7. Species Synechococcus elongatus [TaxId:32046] [48177] (7 PDB entries)
    Uniprot P05327 1-474
  8. Domain d1qnfa1: 1qnf A:205-475 [18777]
    Other proteins in same PDB: d1qnfa2
    complexed with fad, hdf

Details for d1qnfa1

PDB Entry: 1qnf (more details), 1.8 Å

PDB Description: structure of photolyase
PDB Compounds: (A:) photolyase

SCOPe Domain Sequences for d1qnfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnfa1 a.99.1.1 (A:205-475) C-terminal domain of DNA photolyase {Synechococcus elongatus [TaxId: 32046]}
pvepgetaaiarlqefcdraiadydpqrnfpaeagtsglspalkfgaigirqawqaasaa
halsrsdearnsirvwqqelawrefyqhalyhfpsladgpyrslwqqfpwenrealftaw
tqaqtgypivdaamrqltetgwmhnrcrmivasfltkdliidwrrgeqffmqhlvdgdla
annggwqwsassgmdpkplrifnpasqakkfdatatyikrwlpelrhvhpkdlisgeitp
ierrgypapivnhnlrqkqfkalynqlkaai

SCOPe Domain Coordinates for d1qnfa1 are not available.

Timeline for d1qnfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qnfa2