SCOP 1.65: Domain d1qnf_2: 1qnf 1-204

Lineage for d1qnf_2 (1qnf 1-204)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (1 family)

5. Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (2 proteins)

6. Protein DNA photolyase [52427] (3 species)
   binds a light-harvesting cofactor

7. Species Anacystis nidulans [52429] (1 PDB entry)
   cofactor is HDF

8. Domain d1qnf_2: 1qnf 1-204 [31632]
   Other proteins in same PDB: d1qnf_1
   complexed with fad, hdf

Details for d1qnf_2

PDB Entry: 1qnf, 1.8 Å

PDB Description: structure of photolyase

SCOP Domain Sequences for d1qnf_2:

Sequence; same for both SEQRES and ATOM records:

>d1qnf_2 c.28.1.1 (1-204) DNA photolyase {Anacystis nidulans}
maapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclq
elqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalkta
giravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlt
aiaplllselptlkqlgfdwdggf

Timeline for d1qnf_2:

• d1qnf_2 first appeared (with stable ids) in SCOP 1.55
  
• d1qnf_2 appears in SCOP 1.63
  
• d1qnf_2 appears in SCOP 1.67
  
• d1qnf_2 appears in the current release, SCOPe 2.08, called d1qnfa2