SCOP 1.59: Domain d1rlr_1: 1rlr 10-221

Lineage for d1rlr_1 (1rlr 10-221)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)

4. Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family)

5. Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)

6. Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (1 species)

7. Species Escherichia coli [TaxId:562] [48171] (8 PDB entries)

8. Domain d1rlr_1: 1rlr 10-221 [18753]
   Other proteins in same PDB: d1rlr_2

Details for d1rlr_1

PDB Entry: 1rlr, 2.5 Å

PDB Description: structure of ribonucleotide reductase protein r1

SCOP Domain Sequences for d1rlr_1:

Sequence; same for both SEQRES and ATOM records:

>d1rlr_1 a.98.1.1 (10-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli}
rdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiikaaadl
isrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyteeefk
qmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsnypretr
lqyvkrfydavstfkislptpimsgvrtptrq

Timeline for d1rlr_1:

• d1rlr_1 first appeared (with stable ids) in SCOP 1.55
  
• d1rlr_1 appears in SCOP 1.57
  
• d1rlr_1 appears in SCOP 1.61
  
• d1rlr_1 appears in the current release, SCOPe 2.08, called d1rlra1