Lineage for d1rlr_1 (1rlr 10-221)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5484Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
  4. 5485Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) (S)
  5. 5486Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)
  6. 5487Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (1 species)
  7. 5488Species Escherichia coli [TaxId:562] [48171] (8 PDB entries)
  8. 5489Domain d1rlr_1: 1rlr 10-221 [18753]
    Other proteins in same PDB: d1rlr_2

Details for d1rlr_1

PDB Entry: 1rlr (more details), 2.5 Å

PDB Description: structure of ribonucleotide reductase protein r1

SCOP Domain Sequences for d1rlr_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlr_1 a.98.1.1 (10-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli}
rdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiikaaadl
isrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyteeefk
qmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsnypretr
lqyvkrfydavstfkislptpimsgvrtptrq

SCOP Domain Coordinates for d1rlr_1:

Click to download the PDB-style file with coordinates for d1rlr_1.
(The format of our PDB-style files is described here.)

Timeline for d1rlr_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rlr_2